Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148662112
StrainMtb_H37Ra
Protein IDYP_001283635.1
Description lipoprotein LppO [Mycobacterium tuberculosis H37Ra]
Sequence MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATV
MVEGHTHTISGVVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLS
DSTPPDVNGFGISLKIGSVDYQMPYQPVQSPTQVEATRQGKSYTLTGTGH
AVIPGQTGMRELPFGVHVTCP
B cell epitope (IEDB)0
T cell epitope (IEDB)2
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)11
MHC class 1 prediction (Propred1)101
CTL epitope prediction (CTLpred)15
Prediction of interferon-gamma inducing peptides (IFNepitope)72
Prediction of IL4 inducing peptides (IL4pred)111