Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148662178
StrainMtb_H37Ra
Protein IDYP_001283701.1
Description membrane-associated phospholipase C 2 [Mycobacterium tuberculosis H
Sequence MTRRQFFAKAAAATTAGAFMSLAGPIIEKAYGAGPCPGHLTDIEHIVLLM
QENRSFDHYFGTLSDTRGFDDTTPPVVFAQSGWNPMTQAVDPAGVTLPYR
FDTTRGPLVAGECVNDPDHSWIGMHNSWNGGANDNWLPAQVPFSPLQGNV
PVTMGFYTRRDLPIHYLLADTFTVCDGYFCSLLGGTTPNRLYWMSAWIDP
DGTDGGPVLIEPNIQPLQHYSWRIMPENLEDAGVSWKVYQNKLLGALNNT
VVGYNGLVNDFKQAADPRSNLARFGISPTYPLDFAADVRNNRLPKVSWVL
PGFLLSEHPAFPVNVGAVAIVDALRILLSNPAVWEKTALIVNYDENGGFF
DHVVPPTPPPGTPGEFVTVPDIDSVPGSGGIRGPIGLGFRVPCLVISPYS
RGPLMVHDTFDHTSTLKLIRARFGVPVPNLTAWRDATVGDMTSTFNFAAP
PNPSKPNLDHPRLNALPKLPQCVPNAVLGTVTKTAIPYRVPFPQSMPTQE
TAPTRGIPSGLC
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)117
MHC class II prediction (Propred)146
MHC class 1 prediction (Propred1)669
CTL epitope prediction (CTLpred)122
Prediction of interferon-gamma inducing peptides (IFNepitope)297
Prediction of IL4 inducing peptides (IL4pred)748