Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 148825082 |
Strain | Mtb_F11 |
Protein ID | YP_001289836.1 |
Description | 10 kDa culture filtrate antigen EsxB [Mycobacterium tuberculosis F1 |
Sequence | MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA AQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF |
B cell epitope (IEDB) | 26 |
T cell epitope (IEDB) | 280 |
MHC binder (IEDB) | 351 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 12 |
MHC class II prediction (Propred) | 27 |
MHC class 1 prediction (Propred1) | 166 |
CTL epitope prediction (CTLpred) | 18 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 90 |
Prediction of IL4 inducing peptides (IL4pred) | 202 |