Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15607295
StrainMtb_H37Rv
Protein IDNP_214667.1
Description ptbB gene product [Mycobacterium tuberculosis H37Rv]
Sequence MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLRRLGIT
DVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKR
LLTNDGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLL
AAGRPVLTHCFAGKDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLR
ARISEMIQQRFDTELAPEVVTFTKARLSDGVLGVRAEYLAAARQTIDETY
GSLGGYLRDAGISQATVNRMRGVLLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)193
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)120
Prediction of IL4 inducing peptides (IL4pred)137