Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15608375
StrainMtb_H37Rv
Protein IDNP_215751.1
Description lpqY gene product [Mycobacterium tuberculosis H37Rv]
Sequence MVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVVSFYTPATDGATFTAI
AQRCNQQFGGRFTIAQVSLPRSPNEQRLQLARRLTGNDRTLDVMALDVVW
TAEFAEAGWALPLSDDPAGLAENDAVADTLPGPLATAGWNHKLYAAPVTT
NTQLLWYRPDLVNSPPTDWNAMIAEAARLHAAGEPSWIAVQANQGEGLVV
WFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQILKSVATTPGAD
PSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRI
PQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIG
GLNLAVAKTTRHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQ
FQAKYPMHAIIRQQLTDAAVRPATPVYQALSIRLAAVLSPITEIDPESTA
DELAAQAQKAIDGMGLLP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)321
CTL epitope prediction (CTLpred)65
Prediction of interferon-gamma inducing peptides (IFNepitope)185
Prediction of IL4 inducing peptides (IL4pred)235