Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15609116
StrainMtb_H37Rv
Protein IDNP_216495.1
Description unnamed protein product [Mycobacterium tuberculosis H37Rv]
Sequence MVGPRTRGYAIHKLGFCSVVMLGINSIIGAGIFLTPGEVIGLAGPFAPMA
YVLAGIFAGVVAIVFATAARYVRTNGASYAYTTAAFGRRIGIYVGVTHAI
TASIAWGVLASFFVSTLLRVAFPDKAWADAEQLFSVKTLTFLGFIGVLLA
INLFGNRAIKWANGTSTVGKAFALSAFIVGGLWIITTQHVNNYATAWSAY
SATPYSLLGVAEIGKGTFSSMALATIVALYAFTGFESIANAAEEMDAPDR
NLPRAIPIAIFSVGAIYLLTLTVAMLLGSNKIAASDDTVKLAAAIGNATF
RTIIVVGALISMFGINVAASFGAPRLWTALADSGVLPTRLSRKNQYDVPM
VSFAITASLALAFPLALRFDNLHLTGLAVIARFVQFIIVPIALIALARSQ
AVEHAAVRRNAFTDKVLPLVAIVVSVGLAVSYDYRCIFLVRGGPNYFSIA
LIVITFVVVPAMAYLHYYRIIRRVGDRPSTR
B cell epitope (IEDB)0
T cell epitope (IEDB)8
MHC binder (IEDB)14
Vaccine TargetYes
B cell prediction (LBtope)31
MHC class II prediction (Propred)131
MHC class 1 prediction (Propred1)379
CTL epitope prediction (CTLpred)115
Prediction of interferon-gamma inducing peptides (IFNepitope)174
Prediction of IL4 inducing peptides (IL4pred)295