Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 15609582 |
| Strain | Mtb_H37Rv |
| Protein ID | NP_216961.1 |
| Description | ndk gene product [Mycobacterium tuberculosis H37Rv] |
| Sequence | MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 16 |
| MHC class II prediction (Propred) | 19 |
| MHC class 1 prediction (Propred1) | 84 |
| CTL epitope prediction (CTLpred) | 19 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 58 |
| Prediction of IL4 inducing peptides (IL4pred) | 88 |