Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15610802
StrainMtb_H37Rv
Protein IDNP_218183.1
Description dppA gene product [Mycobacterium tuberculosis H37Rv]
Sequence MVRQMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTG
TNDSNGGRIIDRLFAGLMSYDAVGKPSLEVAQSIESADNVNYRITVKPGW
KFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKS
RTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFG
RNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFY
ANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDT
PLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPG
FDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVD
AVANSIKNVLGIDAVAAPQPTFAGFRTQITNRAIDSAFRAGWRGDYPSMI
EFLAPLFTAGAGSNDVGYINPEFDAALAAAEAAPTLTESHELVNDAQRIL
FHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYENIVKA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)8
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)69
MHC class 1 prediction (Propred1)359
CTL epitope prediction (CTLpred)76
Prediction of interferon-gamma inducing peptides (IFNepitope)215
Prediction of IL4 inducing peptides (IL4pred)387