Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15611010
StrainMtb_H37Rv
Protein IDNP_218391.1
Description esxB gene product [Mycobacterium tuberculosis H37Rv]
Sequence MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA
AQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF
B cell epitope (IEDB)0
T cell epitope (IEDB)280
MHC binder (IEDB)351
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)27
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)90
Prediction of IL4 inducing peptides (IL4pred)202