Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15839882
StrainMtb_CDC_1551
Protein IDNP_334919.1
Description DNA-binding response regulator RegX3 [Mycobacterium tuberculosis CDC155
Sequence MALMTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGAD
IVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADD
YVTKPYSARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSV
NGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVH
VKRLRSKIEADPANPVHLVTVRGLGYKLEG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)38
MHC class 1 prediction (Propred1)158
CTL epitope prediction (CTLpred)42
Prediction of interferon-gamma inducing peptides (IFNepitope)67
Prediction of IL4 inducing peptides (IL4pred)169