Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15840395
StrainMtb_CDC_1551
Protein IDNP_335432.1
Description cation transporter E1-E2 family ATPase [Mycobacterium tuberculosis CDC1
Sequence MTTDVLSDTDVSLKVVSNASGRMRVCVTGFNVDAVRAVAIEETVSQVTGV
HAVHAYPRTASVVIWYSPELGDTAAVLSAITKAQHVPAELVPARAPHSAG
VRGVGVVRKITGGIRRMLSRPPGVDKPLKASRCGGRPRGPVRGSASWPGE
QNRRERRTWLPRVWLALPLGLLALGSSMFFGAYPWAGWLAFAATLPVQFV
AGWPILRGAVQQARALTSNMDTLIALGTLTAFVYSTYQLFAGGPLFFDTS
ALIIAFVVLGRHLEARATGKASEAISKLLELGAKEATLLVDGQELLVPVD
QVQVGDLVRVRPGEKIPVDGEVTDGRAAVDESMLTGESVPVEKTAGDRVA
GATVNLDGLLTVRATAVGADTALAQIVRLVEQAQGDKAPVQRLADRVSAV
FVPAVIGVAVATFAGWTLIAANPVAGMTAAVAVLIIACPCALGLATPTAI
MVGTGRGAELGILVKGGEVLEASKKIDTVVFDKTGTLTRARMRVTDVIAG
QRRQPDQVLRLAAAVESGSEHPIGAAIVAAAHERGLAIPAANAFTAVAGH
GVRAQVNGGPVVVGRRKLVDEQHLVLPDHLAAAAVEQEERGRTAVFVGQD
GQVVGVLAVADTVKDDAADVVGRLHAMGLQVAMITGDNARTAAAIAKQVG
IEKVLAEVLPQDKVAEVRRLQDQGRVVAMVGDGVNDAPALVQADLGIAIG
TGTDVAIEASDITLMSGRLDGVVRAIELSRQTLRTIYQNLGWAFGYNTAA
IPLAALGALNPVVAGAAMGFSSVSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)53
MHC class II prediction (Propred)133
MHC class 1 prediction (Propred1)559
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)375
Prediction of IL4 inducing peptides (IL4pred)476