Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15840869
StrainMtb_CDC_1551
Protein IDNP_335906.1
Description lipoprotein- 27 kDa [Mycobacterium tuberculosis CDC1551]
Sequence MQGMRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEE
ATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGG
SDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLA
NFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQ
ETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)144
CTL epitope prediction (CTLpred)28
Prediction of interferon-gamma inducing peptides (IFNepitope)71
Prediction of IL4 inducing peptides (IL4pred)132