Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15841518
StrainMtb_CDC_1551
Protein IDNP_336555.1
Description heat shock protein 20 [Mycobacterium tuberculosis CDC1551]
Sequence MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR
YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR
TVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
B cell epitope (IEDB)0
T cell epitope (IEDB)236
MHC binder (IEDB)592
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)98
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)71
Prediction of IL4 inducing peptides (IL4pred)53