Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15841561
StrainMtb_CDC_1551
Protein IDNP_336598.1
Description precorrin-6y c5-15-methyltransferase [Mycobacterium tuberculosis CDC155
Sequence MIIVVGIGADGMTGLSEHSRSELRRATVIYGSKRQLALLDDTVTAERWEW
PTPMLPAVQGLSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVLPHV
SAVTLACARMGWNVYDTEVISLVTAQPHTAVRRGGRAIVLSGDRSTPQAL
AVLLTEHGRGDSKFSVLEQLGGPAERRRDGTARAWACDPPLDVDELNVIA
VRYLPDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRPGQRLWDVGAG
SGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA
FDDAARPSVIFLGGGVTQPGLLEACLHSLPAGGNLVANAVTVESEAALAH
AYSRLGGELRRFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)31
MHC class II prediction (Propred)53
MHC class 1 prediction (Propred1)247
CTL epitope prediction (CTLpred)64
Prediction of interferon-gamma inducing peptides (IFNepitope)153
Prediction of IL4 inducing peptides (IL4pred)225