Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 15841969 |
Strain | Mtb_CDC_1551 |
Protein ID | NP_337006.1 |
Description | nucleoside diphosphate kinase [Mycobacterium tuberculosis CDC1551] |
Sequence | MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 16 |
MHC class II prediction (Propred) | 19 |
MHC class 1 prediction (Propred1) | 84 |
CTL epitope prediction (CTLpred) | 19 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 58 |
Prediction of IL4 inducing peptides (IL4pred) | 88 |