Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 15841969 |
| Strain | Mtb_CDC_1551 |
| Protein ID | NP_337006.1 |
| Description | nucleoside diphosphate kinase [Mycobacterium tuberculosis CDC1551] |
| Sequence | MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 16 |
| MHC class II prediction (Propred) | 19 |
| MHC class 1 prediction (Propred1) | 84 |
| CTL epitope prediction (CTLpred) | 19 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 58 |
| Prediction of IL4 inducing peptides (IL4pred) | 88 |