Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15842825
StrainMtb_CDC_1551
Protein IDNP_337862.1
Description cation/proton antiporter [Mycobacterium tuberculosis CDC1551]
Sequence MEVSRALLFELGVLLAVLAVLGAVARRFALSPIPVYLLAGLSLGNGGILG
VAAAGEFIATGAPIGVVLLLLALGLEFSATEFASSLRHHLPSAGVDIVLN
ATPGAVAGWLLGLDGVAILGLAGVTYISSSGVIARLLEDLRRLGNRETPA
VLSVLVLEDFAMAAYLPLFAVLATDGSWLEAVVGMTVAIAALLGAFAASY
RWGHHVGRLVTHPDSEQLLLRVLGITLIVAAVAESLHASAAVGAFLVGLT
LTGETADRARMVLTPLRDLFATIFFLGIGLSVDPGKLVSMLPVALALAAV
TAATKVATGMFAARREGVARRGQLRAGTALVARGEFSLIIIGLAGASIPG
VAALATAYVFVMAIVGPILARYTGGGLPAAAVASN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)23
MHC class II prediction (Propred)94
MHC class 1 prediction (Propred1)277
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)133
Prediction of IL4 inducing peptides (IL4pred)199