Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15843383
StrainMtb_CDC_1551
Protein IDNP_338420.1
Description lipoprotein [Mycobacterium tuberculosis CDC1551]
Sequence MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGP
KVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSV
GLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNK
SFEIEVTSS
B cell epitope (IEDB)0
T cell epitope (IEDB)126
MHC binder (IEDB)27
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)11
MHC class 1 prediction (Propred1)89
CTL epitope prediction (CTLpred)11
Prediction of interferon-gamma inducing peptides (IFNepitope)28
Prediction of IL4 inducing peptides (IL4pred)101