Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15843426
StrainMtb_CDC_1551
Protein IDNP_338463.1
Description esterase- - antigen 85-A [Mycobacterium tuberculosis CDC1551]
Sequence MRPNMHGCVEMRMREARMQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVG
AVGGTATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLD
GLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKA
GCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHP
QQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQR
NDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKF
QDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGP
APQGA
B cell epitope (IEDB)0
T cell epitope (IEDB)280
MHC binder (IEDB)73
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)221
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)200
Prediction of IL4 inducing peptides (IL4pred)220