Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15843480
StrainMtb_CDC_1551
Protein IDNP_338517.1
Description hypothetical protein MT3964 [Mycobacterium tuberculosis CDC1551]
Sequence MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQXRS
GNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVR
RIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)88
CTL epitope prediction (CTLpred)22
Prediction of interferon-gamma inducing peptides (IFNepitope)43
Prediction of IL4 inducing peptides (IL4pred)67