Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID15843496
StrainMtb_CDC_1551
Protein IDNP_338533.1
Description hypothetical protein MT3978 [Mycobacterium tuberculosis CDC1551]
Sequence MASGSGLCKTTSNFIWGQLLLLGEGIPDPGDIFNTGSSLFKQISDKMGLA
IPGTNWIGQAAEAYLNQNIAQQLRAQVMGDLDKLTGNMISNQAKYVSDTR
DVLRAMKKMIDGVYKVCKGLEKIPLLGHLWSWELAIPMSGIAMAVVGGAL
LYLTIMTLMNATNLRGILGRLIEMLTTLPKFPGLPGLPSLPDIIDGLWPP
KLPDIPIPGLPDIPGLPDFKWPPTPGSPLFPDLPSFPGFPGFPEFPAIPG
FPALPGLPSIPNLFPGLPGLGDLLPGVGDLGKLPTWTELAALPDFLGGFA
GLPSLGFGNLLSFASLPTVGQVTATMGQLQQLVAAGGGPSQLASMGSQQA
QLISSQAQQGGQQHATLVSDKKEDEEGVAEAERAPIDAGTAASQRGQEGT
VL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)67
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)243
CTL epitope prediction (CTLpred)37
Prediction of interferon-gamma inducing peptides (IFNepitope)168
Prediction of IL4 inducing peptides (IL4pred)256