Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID221230166
StrainM_leprae_Br4923
Protein IDYP_002503582.1
Description DNA-binding protein [Mycobacterium leprae Br4923]
Sequence MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMCETTTMLKVGTAALMLEMVETGVPFRDFSLDNPIR
AIREVSHDITGRRPVRLAGGRQASALDIQREYYTRAFEHLQTREPNVQFE
QVVDLWGRQLDAIESQDFAKVDTEIDWVIKRKLFQRYQDRDNMELTDPKI
AQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIADAVNHPPQTTRARL
RGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
gene ID221230166
StrainM_leprae_Br4923
Protein IDYP_002503582.1
Description DNA-binding protein [Mycobacterium leprae Br4923]
Sequence MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDNLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMCETTTMLKVGTAALMLEMVETGVPFRDFSLDNPIR
AIREVSHDITGRRPVRLAGGRQASALDIQREYYTRAFEHLQTREPNVQFE
QVVDLWGRQLDAIESQDFAKVDTEIDWVIKRKLFQRYQDRDNMELTDPKI
AQLDLAYHDIKRGRGVFDLLQRKGLAARVTTDEDIADAVNHPPQTTRARL
RGEFISAAQAAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)321
CTL epitope prediction (CTLpred)77
Prediction of interferon-gamma inducing peptides (IFNepitope)161
Prediction of IL4 inducing peptides (IL4pred)311