Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224988857
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002643544.1
Description mycolic acid synthase [Mycobacterium bovis BCG str. Tokyo 172]
Sequence MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQI
AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQA
GHVQKMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHF
FEVPHRTLPADGKMLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIF
PGGWLPSIPTVHEYAEKVGFRVTAVQSLQLHYARTLDMWATALEANKDQA
IAIQSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)34
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)203
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)129
Prediction of IL4 inducing peptides (IL4pred)241