Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224988963
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002643650.1
Description nicotinate phosphoribosyltransferase [Mycobacterium bovis BCG str.
Sequence MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMA
AGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAP
EGTVIFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAAR
GRPVVDFGARRAHGTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTM
AHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDHVIELAKRLGN
RFDVRAVRLDSGDLDELSKATRARLDTAGLEQVEIFASSGLDENRIAALL
AARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPG
RKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDG
ARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAH
PGSNVVGAKAKRP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)326
CTL epitope prediction (CTLpred)82
Prediction of interferon-gamma inducing peptides (IFNepitope)198
Prediction of IL4 inducing peptides (IL4pred)313