Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224988976
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002643663.1
Description transcriptional regulatory protein [Mycobacterium bovis BCG str. To
Sequence MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPA
VREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISV
VRSILEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRH
TLDFWDHVVDSAGSIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYR
KLADAICSGDPTGAKKAAQDLLELANTSLMAVLVSQASRQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)32
MHC class 1 prediction (Propred1)160
CTL epitope prediction (CTLpred)49
Prediction of interferon-gamma inducing peptides (IFNepitope)104
Prediction of IL4 inducing peptides (IL4pred)129