Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224989366
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002644053.1
Description metal cation transporter P-type ATPase [Mycobacterium bovis BCG str
Sequence MRVCVTGFNVDAVRAVAIEETVSQVTGVHAVHAYPRTASVVIWYSPELGD
TAAVLSAITKAQHVPAELVPARAPHSAGVRGVGVVRKITGGIRRMLSRPP
GVDKPLKASRCGGRPRGPVRGSASWPGEQNRRERRTWLPRVWLALPLGLL
ALGSSMFFGAYPWAGWLAFAATLPVQFVAGWPILRGAVQQARALTSNMDT
LIALGTLTAFVYSTYQLFAGGPLFFDTSALIIAFVVLGRHLEARATGKAS
EAISKLLELGAKEATLLVDGQELLVPVDQVQVGDLVRVRPGEKIPVDGEV
TDGRAAVDESMLTGESVPVEKTAGDRVAGATVNLDGLLTVRATAVGADTA
LAQIVRLVEQAQGDKAPVQRLADRVSAVFVPAVIGVAVATFAGWTLIAAN
PVAGMTAAVAVLIIACPCALGLATPTAIMVGTGRGAELGILVKGGEVLEA
SKKIDTVVFDKTGTLTRARMRVTDVIAGQRRQPNQVLRLAAAVESGSEHP
IGAAIVAAAHERGLAIPAANAFTAVAGHGVRAQVNGGPVVVGRRKLVDEQ
HLVLPDHLAAAAVEQEERGRTAVFVGQDGQVVGVLAVADTVKDDAADVVG
RLHAMGLQVAMITGDNARTAAAIAKQVGIEKVLAEVLPQDKVAEVRRLQD
QGRVVAMVGDGVNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLDGV
VRAIELSRQTLRTIYQNLGWAFGYNTAAIPLAALGALNPVVAGAAMGFSS
VSVVTNSLRLRRFGRDGRTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)53
MHC class II prediction (Propred)129
MHC class 1 prediction (Propred1)541
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)368
Prediction of IL4 inducing peptides (IL4pred)460