Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224989380
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002644067.1
Description mycobacterial persistence regulator [Mycobacterium bovis BCG str. T
Sequence MSVRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDAL
VLDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTKPEDAAESMAMRFSDLTLDPVTREVNRGQ
RRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVG
YLRRKTEADGEPRLIHTVRGVGYVLRETPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)22
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)159
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)80
Prediction of IL4 inducing peptides (IL4pred)152