Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224989389
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002644076.1
Description hypothetical protein JTY_1017 [Mycobacterium bovis BCG str. Tokyo 1
Sequence MAESSLNPSLVSRISAFLRPDWTRTVRARRFAAAGLVMLAGVAALRSNPE
DDRAEVVVAAHDLRPGTALTPGDVRLEKRSATTLPDGSQADLDAVVGSTL
ASPTRRGEVLTDVRLLGSRLAESTAGPDARIVPLHLADSALVDLVRVGDV
VDVLAAPVTDSPAALRLLATDAIVVLVSAQQKAQAADSDRVVLVALPARL
ANTVAGAALGQTVTLTLH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)33
MHC class 1 prediction (Propred1)155
CTL epitope prediction (CTLpred)34
Prediction of interferon-gamma inducing peptides (IFNepitope)71
Prediction of IL4 inducing peptides (IL4pred)91