Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224990407
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002645094.1
Description histidine kinase response regulator [Mycobacterium bovis BCG str. T
Sequence MTHPDRANVNPGSPPVRETLSQLRLRELLLEVQDRIEQIVEGRDRLDGLI
DAILAITSGLKLDATLRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEG
IDEETRHLIGSLPEGRGVLGALIEEPKPIRLDDISRHPASVGFPLHHPPM
RTFLGVPVRIRDEVFGNLYLTEKADGQPFSDDDEVLVQALAAAAGIAVDN
ARLFEESRTREAWIEATRDIGTQMLAGADPAMVFRLIAEEALTLMAGAAT
LVAVPLDDEAPACEVDDLVIVEVAGEISPAVKQMTVAVSGTSIGGVFHDR
TPRRFDRLDLAVDGPVEPGPALVLPLRAADTVAGVLVALRSADEQPFSDK
QLDMMAAFADQAALAWRLATAQRQMREVEILTDRDRIARDLHDHVIQRLF
AVGLTLQGAAPRARVPAVRESIYSSIDDLQEIIQEIRSAIFDLHAGPSRA
TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSN
AVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDA
GGEFTVENMPTGGTLLRWSAPLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)61
MHC class II prediction (Propred)68
MHC class 1 prediction (Propred1)394
CTL epitope prediction (CTLpred)95
Prediction of interferon-gamma inducing peptides (IFNepitope)239
Prediction of IL4 inducing peptides (IL4pred)380