Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224990505
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002645192.1
Description short chain dehydrogenase [Mycobacterium bovis BCG str. Tokyo 172]
Sequence MTSLQGKVVFITGAARGIGAEVARRLHNKGAKLVLTDLSKSELAVMGAEL
GGDDRLLTVVADVRDLPAMQAAAETAVERFGGIDVVVANAGIASYGSVLK
VDPQAFRRVLDVNLLGNFHTVRATLPALIDRRGYVLIVSSLAAFAAPPGM
APYNMSKAGNEHFANALRLEVAHLGVSVGSAHMSWIDTALVRDTKADLPA
FAELLARLPWPLNKTTSVNKCAAAFVNGIEGRKDRVYCPGWVALFRWLKP
LLSTRVGQRPIRNTVAKLMPQMDAEVAALGRFASAYTESLENS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)49
MHC class 1 prediction (Propred1)213
CTL epitope prediction (CTLpred)46
Prediction of interferon-gamma inducing peptides (IFNepitope)103
Prediction of IL4 inducing peptides (IL4pred)209