Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 224991115 |
| Strain | M_bovis_BCG_str_Tokyo_172 |
| Protein ID | YP_002645804.1 |
| Description | transcriptional regulatory protein [Mycobacterium bovis BCG str. To |
| Sequence | MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSS ELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTK VVIAPVVSLAVA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 4 |
| MHC class II prediction (Propred) | 15 |
| MHC class 1 prediction (Propred1) | 75 |
| CTL epitope prediction (CTLpred) | 19 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 29 |
| Prediction of IL4 inducing peptides (IL4pred) | 72 |