Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID224992287
StrainM_bovis_BCG_str_Tokyo_172
Protein IDYP_002646977.1
Description hypothetical protein JTY_3939 [Mycobacterium bovis BCG str. Tokyo 1
Sequence MRNPLGLRFSTGHALLASALAPPCIIAFLETRYWWAGIALASLGVIVATV
TFYGRRITGWVAAVYAWLRRRRRPPDSSSEPVVGATVKPGDHVAVRWQGE
FLVAVIELIPRPFTPTVIVDGQAHTDDMLDTGLVEELLSVHCPDLEADIV
SAGYRVGNTAAPDVVSLYQQVIGTDPAPANRRTWIVLRADPERTRKSAQR
RDEGVAGLARYLVASATRIADRLASHGVDAVCGRSFDDYDHATDIGFVRE
KWSMIKGRDAYTAAYAAPGGPDVWWSARADHTITRVRVAPGMAPQSTVLL
TTADKPKTPRGFARLFGGQRPALQGQHLVANRHCQLPIGSAGVLVGETVN
RCPVYMPFDDVDIALNLGDAQTFTQFVVRAAAAGAMVTVGPQFEEFARLI
GAHIGQEVKVAWPNATTYLGPHPGIDRVILRHNVIGTPRHRQLPIRRVSP
PEESRYQMALPK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)29
MHC class II prediction (Propred)70
MHC class 1 prediction (Propred1)322
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)210
Prediction of IL4 inducing peptides (IL4pred)310