Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID240168353
StrainM_kansasii_ATCC_12478
Protein IDZP_04747012.1
Description Esat-6 like protein EsxB [Mycobacterium kansasii ATCC 12478]
Sequence MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAASLQAQWRGAAGTA
AQAAVVRFQEAANKQKAELEEISTNIRQAGVQYSKADEEQQQALSSQMGF
B cell epitope (IEDB)13
T cell epitope (IEDB)108
MHC binder (IEDB)181
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)113
CTL epitope prediction (CTLpred)14
Prediction of interferon-gamma inducing peptides (IFNepitope)66
Prediction of IL4 inducing peptides (IL4pred)135