Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID240169687
StrainM_kansasii_ATCC_12478
Protein IDZP_04748346.1
Description iron-dependent repressor and activator IdeR [Mycobacterium kansasii
Sequence MNDLVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMER
DGLLRVAGDRHLELTDKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLLDLGVGPEFGAEDAN
LVRLTELPAGPPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETS
PGGGVTIVIPGHENVTLPHAMAHAVKVEKV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)147
CTL epitope prediction (CTLpred)32
Prediction of interferon-gamma inducing peptides (IFNepitope)86
Prediction of IL4 inducing peptides (IL4pred)138