Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253798973
StrainMtb_KZN_1435
Protein IDYP_003031974.1
Description permease [Mycobacterium tuberculosis KZN 1435]
Sequence MVGPRTRGYAIHKLGFCSVVMLGINSIIGAGIFLTPGDVIGLAGPFAPMA
YVLAGIFAGVVAIVFATAARYVRTNGASYAYTTAAFGRRIGIYVGVTHAI
TASIAWGVLASFFVSTLLRVAFPDKAWADAEQLFSVKTLTFLGFIGVLLA
INLFGNRAIKWANGTSTVGKAFALSAFIVGGLWIITTQHVNNYATAWSAY
SATPYSLLGVAEIGKGTFSSMALATIVALYAFTGFESIANAAEEMDAPDR
NLPRAIPIAIFSVGAIYLLTLTVAMLLGSNKIAASDDTVKLAAAIGNATF
RTIIVVGALISMFGINVAASFGAPRLWTALADSGVLPTRLSRKNQYDVPM
VSFAITASLALAFPLALRFDNLHLTGLAVIARFVQFIIVPIALIALARSQ
AVEHAAVRRNAFTDKVLPLVAIVVSVGLAVSYDYRCIFLVRGGPNYFSIA
LIVITFIVVPAMAYLHYYRIIRRVGDRPSTR
B cell epitope (IEDB)3
T cell epitope (IEDB)6
MHC binder (IEDB)14
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)130
MHC class 1 prediction (Propred1)378
CTL epitope prediction (CTLpred)116
Prediction of interferon-gamma inducing peptides (IFNepitope)172
Prediction of IL4 inducing peptides (IL4pred)295