Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID253800463
StrainMtb_KZN_1435
Protein IDYP_003033464.1
Description transcriptional regulator whib-like whiB3 [Mycobacterium tuberculos
Sequence MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAK
EMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRR
TA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)13
MHC class II prediction (Propred)8
MHC class 1 prediction (Propred1)65
CTL epitope prediction (CTLpred)16
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)74