Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297633266
StrainMtb_KZN_4207
Protein IDZP_06951046.1
Description two component system transcriptional regulator phoP [Mycobacterium t
Sequence MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTA
TNGAQALDRARETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTA
RDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAGKGNKEPRNVR
LTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILD
HVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)161
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)84
Prediction of IL4 inducing peptides (IL4pred)164