Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297633333
StrainMtb_KZN_4207
Protein IDZP_06951113.1
Description phosphate-transport system transcriptional regulator phoY2 [Mycobact
Sequence MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHE
KIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQI
REEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEV
ARRVIFQATGAFP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)23
MHC class II prediction (Propred)27
MHC class 1 prediction (Propred1)156
CTL epitope prediction (CTLpred)33
Prediction of interferon-gamma inducing peptides (IFNepitope)99
Prediction of IL4 inducing peptides (IL4pred)139