Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297633418
StrainMtb_KZN_4207
Protein IDZP_06951198.1
Description hypothetical protein MtubK4_04816 [Mycobacterium tuberculosis KZN 42
Sequence MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAF
ERPQSVTGPTGVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDE
AAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPD
FGLKVERDTVTLTGTAPSSEHKDAVKRAATSTWPDMKIVNNIEVTGQAPP
GPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKAC
PDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL
GSVNPIASNATPEGRAKNRRVEIVVN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)39
MHC class 1 prediction (Propred1)209
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)111
Prediction of IL4 inducing peptides (IL4pred)214