Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297633453
StrainMtb_KZN_4207
Protein IDZP_06951233.1
Description transmembrane serine/threonine-protein kinase D pknD [Mycobacterium
Sequence MSDAVPQVGSQFGPYQLLRLLGRGGMGEVYEAEDTRKHRVVALKLISPQY
SDNAVFRARMQREADTAGRLTEPHIVPIHDYGEINGQFFVEMRMIDGTSL
RALLKQYGPLTPARAVAIVRQIAAALDAAHANGVTHRDVKPENILVTASD
FAYLVDFGIARAASDPGLTQTGTAVGTYNYMAPERFTGDEVTYRADIYAL
ACVLGECLTGAPPYRADSVERLIAAHLMDPAPQPSQLRPGRVPPALDQVI
AKGMAKNPAERFMSAGDLAIAAHDALTTSEQHQATTILRRGDNATLLATP
ADTGLSQSESGIAGAGTGPPTPGAARWSPGDSATVAGPLAADSRGGNWPS
QTGHSPAVPNALQASLGHAVPPAGNKRKVWAVVGAAAIVLVAIVAAAGYL
VLRPSWSPTQASGQTVLPFTGIDFRLSPSGVAVDSAGNVYVTSEGMYGRV
VKLATGSTGTTVLPFNGLYQPQGLAVDGAGTVYVTDFNNRVVTLAAGSNN
QTVLPFDGLNYPEGLAVDTQGAVYVADRGNNRVVKLAAGSKTQTVLPFTG
LNDPDGVAVDNSGNVYVTDTDNNRVVKLEAESNNQVVLPFTDITAPWGIA
VDEAGTVYVTEHNTNQVVKLLAGSTTSTVLPFTGLNTPLAVAVDSDRTVY
VADRGNDRVVKLTS
B cell epitope (IEDB)2
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)66
MHC class II prediction (Propred)88
MHC class 1 prediction (Propred1)423
CTL epitope prediction (CTLpred)104
Prediction of interferon-gamma inducing peptides (IFNepitope)258
Prediction of IL4 inducing peptides (IL4pred)390