Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 297634945 |
Strain | Mtb_KZN_4207 |
Protein ID | ZP_06952725.1 |
Description | esat-6 like protein esxP [Mycobacterium tuberculosis KZN 4207] |
Sequence | MATRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAE ATSLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 17 |
MHC binder (IEDB) | 315 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 3 |
MHC class II prediction (Propred) | 9 |
MHC class 1 prediction (Propred1) | 59 |
CTL epitope prediction (CTLpred) | 8 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
Prediction of IL4 inducing peptides (IL4pred) | 66 |