Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297729635
StrainMtb_KZN_R506
Protein IDZP_06958753.1
Description RNA polymerase factor sigma-70 [Mycobacterium tuberculosis KZN R506]
Sequence MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREP
ADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEG
FAGKSSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERR
EVSWLEPLPDVTDDPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLR
DVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAADRLSAPDSPE
AQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYTGWYQGAQAIVTLIH
QQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLHVLDMAADRVS
HVVAFLDTTLFPKFGLPDSL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)60
MHC class 1 prediction (Propred1)261
CTL epitope prediction (CTLpred)61
Prediction of interferon-gamma inducing peptides (IFNepitope)150
Prediction of IL4 inducing peptides (IL4pred)251