Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297731780
StrainMtb_KZN_R506
Protein IDZP_06960898.1
Description cytochrome c oxidase subunit II [Mycobacterium tuberculosis KZN R506
Sequence MTPRGPGRLQRLSQCRPQRGSGGPARGLRQLALAAMLGALAVTVSGCSWS
EALGIGWPEGITPEAHLNRELWIGAVIASLAVGVIVWGLIFWSAVFHRKK
NTDTELPRQFGYNMPLELVLTVIPFLIISVLFYFTVVVQEKMLQIAKDPE
VVIDITSFQWNWKFGYQRVNFKDGTLTYDGADPERKRAMVSKPEGKDKYG
EELVGPVRGLNTEDRTYLNFDKVETLGTSTEIPVLVLPSGKRIEFQMASA
DVIHAFWVPEFLFKRDVMPNPVANNSVNVFQIEEITKTGAFVGHCAEMCG
TYHSMMNFEVRVVTPNDFKAYLQQRIDGKTNAEALRAINQPPLAVTTHPF
DTRRGELAPQPVG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)254
CTL epitope prediction (CTLpred)73
Prediction of interferon-gamma inducing peptides (IFNepitope)142
Prediction of IL4 inducing peptides (IL4pred)240