Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297732265
StrainMtb_KZN_R506
Protein IDZP_06961383.1
Description hypothetical protein MtubKR_14304 [Mycobacterium tuberculosis KZN R5
Sequence MMADAVKYVVMCNCDDEPGALIIAWIDDERPAGGHIQMRSNTRFTETQWG
RHIEWKLECRACRKYAPISEMTAAAILDGFGAKLHELRTSTIPDADDPSI
AEARHVIPFSALCLRLSQLGG
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)15
MHC class 1 prediction (Propred1)73
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)53
Prediction of IL4 inducing peptides (IL4pred)85