Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733486
StrainMtb_KZN_R506
Protein IDZP_06962604.1
Description exported repetitive protein pirG [Mycobacterium tuberculosis KZN R50
Sequence MSAVAALAVASPCAYFLVYESTETTERPEHHEFKQAAVLTDLPGELMSAL
SQGLSQFGINIPPVPSLTGSGDASTGLTGPGLTSPGLTSPGLTSPGLTDP
ALTSPGLTPTLPGSLAAPGTTLAPTPGVGANPALTNPALTSPTGATPGLT
SPTGLDPALGGANEIPITTPVGLDPGADGTYPILGDPTLGTIPSSPATTS
TGGGGLVNDVMQVANELGASQAIDLLKGVLMPSIMQAVQNGGAAAPAASP
PVPPIPAAAAVPPTDPITVPVA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)137
CTL epitope prediction (CTLpred)22
Prediction of interferon-gamma inducing peptides (IFNepitope)107
Prediction of IL4 inducing peptides (IL4pred)138