Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733548
StrainMtb_KZN_R506
Protein IDZP_06962666.1
Description hypothetical protein MtubKR_20755 [Mycobacterium tuberculosis KZN R5
Sequence MTDRLASLFESAVSMLPMSEARSLDLFTEITNYDESACDAWIGRIRCGDT
DRVTLFRAWYSRRNFGQLSGSVQISMSTLNARIAIGGLYGDITYPVTSPL
AITMGFAACEAAQGNYADAMEALEAAPVAGSEHLVAWMKAVVYGAAERWT
DVIDQVKSAGKWPDKFLAGAAGVAHGVAAANLALFTEAERRLTEANDSPA
GEACARAIAWYLAMARRSQGNESAAVALLEWLQTTHPEPKVAAALKDPSY
RLKTTTAEQIASRADPWDPGSVVTDNSGRERLLAEAQAELDRQIGLTRVK
NQIERYRAATLMARVRAAKGMKVAQPSKHMIFTGPPGTGKTTIARVVANI
LAGLGVIAEPKLVETSRKDFVAEYEGQSAVKTAKTIDQALGGVLFIDEAY
ALVQERDGRTDPFGQEALDTLLARMENDRDRLVVIIAGYSSDIDRLLETN
EGLRSRFATRIEFDTYSPEELLEIANVIAAADDSALTAEAAENFLQAAKQ
LEQRMLRGRRALDVAGNGRYARQLVEASEQCRDMRLAQVLDIDTLDEDRL
REINGSDMAEAIAAVHAHLNMRE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)121
MHC class 1 prediction (Propred1)822
CTL epitope prediction (CTLpred)182
Prediction of interferon-gamma inducing peptides (IFNepitope)444
Prediction of IL4 inducing peptides (IL4pred)783