Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733550
StrainMtb_KZN_R506
Protein IDZP_06962668.1
Description hypothetical protein MtubKR_20765 [Mycobacterium tuberculosis KZN R5
Sequence MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAM
LGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINA
DRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRP
ANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWV
VKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHP
PDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLS
DLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGS
AYRIRVHEDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITG
TILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFG
HELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMT
HPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTG
ELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDE
FAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNL
TYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFY
ISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)67
MHC class II prediction (Propred)116
MHC class 1 prediction (Propred1)507
CTL epitope prediction (CTLpred)106
Prediction of interferon-gamma inducing peptides (IFNepitope)288
Prediction of IL4 inducing peptides (IL4pred)509