Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733552
StrainMtb_KZN_R506
Protein IDZP_06962670.1
Description hypothetical protein MtubKR_20775 [Mycobacterium tuberculosis KZN R5
Sequence MEKMSHDPIAADIGTQVSDNALHGVTAGSTALTSVTGLVPAGADEVSAQA
ATAFTSEGIQLLASNASAQDQLHRAGEAVQDVARTYSQIDDGAAGVFA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)3
MHC class II prediction (Propred)4
MHC class 1 prediction (Propred1)56
CTL epitope prediction (CTLpred)5
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)33