Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID297733555
StrainMtb_KZN_R506
Protein IDZP_06962673.1
Description 6 kDa early secretory antigenic target esxA [Mycobacterium tuberculo
Sequence MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA
YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA
B cell epitope (IEDB)34
T cell epitope (IEDB)348
MHC binder (IEDB)417
Vaccine TargetYes
B cell prediction (LBtope)63
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)120
CTL epitope prediction (CTLpred)14
Prediction of interferon-gamma inducing peptides (IFNepitope)100
Prediction of IL4 inducing peptides (IL4pred)145