Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313657447
StrainMtb_KZN_V2475
Protein IDZP_07814327.1
Description methoxy mycolic acid synthase 4 mmaA4 [Mycobacterium tuberculosis KZ
Sequence MAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELT
LEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLT
LSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGH
ENYDDFFKRCFSIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKF
IVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQ
SNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)38
MHC class 1 prediction (Propred1)213
CTL epitope prediction (CTLpred)51
Prediction of interferon-gamma inducing peptides (IFNepitope)93
Prediction of IL4 inducing peptides (IL4pred)237