Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID313658692
StrainMtb_KZN_V2475
Protein IDZP_07815572.1
Description Mg2+ transport ATPase C mgtC [Mycobacterium tuberculosis KZN V2475]
Sequence MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFV
LYAVATEDSSPTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSA
AVGVLAASGHLVFTLIGTGTIVAVHLLGRPLGRLVDRDNAVEDEGLQPYQ
VRVICRPKAETYVRAHIVQRTSSNDITLRGIRTGPAGDDNITLTAHLLMV
GHTPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)53
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)43
Prediction of interferon-gamma inducing peptides (IFNepitope)119
Prediction of IL4 inducing peptides (IL4pred)126